HPA021623

GLOD4 antibody from Atlas Antibodies
C17orf25, CGI-150, HC71
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021623
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021623, RRID:AB_1844365
Product name
Anti-GLOD4
Provider product page
Atlas Antibodies - HPA021623
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ENQKILTPLVSLDTPGKATVQVVILADPDGHEICF
VGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAK
HNKPKASG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -