HPA023248

GLOD4 antibody from Sigma-Aldrich
C17orf25, CGI-150, HC71
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023248
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023248, RRID:AB_1844367
Product name
Anti-GLOD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023248
Antibody type
Polyclonal
Antigen
Glyoxalase domain-containing protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLE
WPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVL
KV
Storage
-20C
Provider Type Product Number
- No reagents -