HPA020461

KLHDC1 antibody from Sigma-Aldrich
MST025
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020461, RRID:AB_1852556
Product name
Anti-KLHDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020461
Antibody type
Polyclonal
Antigen
Kelch domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKT
RPRLWHTACLGKENEIMVFGGSKDDLLALDTGHCN
DLLIFQTQPYSLLRSCLDCIGKNSIMLESQISLLP
PKLLQQVLKKITFWAAANHREEQRVQ
Storage
-20C
Provider Type Product Number
- No reagents -