HPA004338

GNRH2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004338
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004338, RRID:AB_1079012
Product name
Anti-GNRH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004338
Antibody type
Polyclonal
Antigen
Progonadoliberin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HWSHGWYPGGKRALSSAQDPQNALRPPAGSPVQTA
HGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLAR
TLLTAAREPR
Storage
-20C
Provider Type Product Number
- No reagents -