H00010474-M02

TADA3 antibody from Abnova Corporation
ADA3, FLJ20221, FLJ21329, hADA3, NGG1, TADA3L

Antibody data

Product number
H00010474-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010474-M02, RRID:AB_1137057
Product name
TADA3L monoclonal antibody (M02), clone 3H3
Provider product page
Abnova Corporation - H00010474-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TADA3L.
Antigen sequence
MSELKDCPLQFHDFKSVDHLKVCPRYTAVLARSED
DGIGIEELDTLQLELETLLSSASRRLRVLEAETQI
LTDWQDKKGDRRFLKLGRDHELGAPPKHGKPKKQK
LEGKAGHGPGPGPGRPKSKNLQPKIQEYEFTDDPI
DVPRIPKNDAPNRFWASVEPYCADITSEEVRTLEE
LLKPPEDEAEHYKIPPLGKHYSQRWAQEDLLEEQK
DGARAAAVADKKKGLMGPLTELDTKDVDALLKKSE
AQHEQPEDGCPFGALTQRLLQALVEENIISPMEDS
PIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLE
SRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQ
AELKALSAHNRTKKHDLLRLAKEEVSRQELRQRVR
MADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTL
KERESILKLLDG
Isotype
IgG
Antibody clone number
3H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -