Antibody data
- Product number
- HPA021476
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021476, RRID:AB_1849858
- Product name
- Anti-GMPR
- Provider product page
- Atlas Antibodies - HPA021476
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFAT
NHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKF
ICLDVANGYS
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
A Purine Nucleotide Biosynthesis Enzyme Guanosine Monophosphate Reductase Is a Suppressor of Melanoma Invasion
Wawrzyniak J, Bianchi-Smiraglia A, Bshara W, Mannava S, Ackroyd J, Bagati A, Omilian A, Im M, Fedtsova N, Miecznikowski J, Moparthy K, Zucker S, Zhu Q, Kozlova N, Berman A, Hoek K, Gudkov A, Shewach D, Morrison C, Nikiforov M
Cell Reports 2013 October;5(2):493-507
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image

- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and GMPR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416357).
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human prostate shows weak cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human malignant melanoma shows moderate cytoplasmic positivity in tumor cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
- Sample type
- HUMAN