H00002766-M01A

GMPR antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00002766-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002766-M01A, RRID:AB_1237720
Product name
GMPR monoclonal antibody (M01A), clone 3G12
Provider product page
Abnova Corporation - H00002766-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GMPR.
Antigen sequence
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERT
FTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQH
SMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGS
GQNDLEKMTSILEAV
Isotype
IgM
Antibody clone number
3G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -