HPA021476

GMPR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021476
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021476, RRID:AB_1849858
Product name
Anti-GMPR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021476
Antibody type
Polyclonal
Antigen
GMP reductase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFAT
NHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKF
ICLDVANGYS
Storage
-20C
Provider Type Product Number
- No reagents -