HPA019513

ERC1 antibody from Sigma-Aldrich
CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019513
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019513, RRID:AB_1856012
Product name
Anti-ERC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019513
Antibody type
Polyclonal
Antigen
ELKS/RAB6-interacting/CAST family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILR
GLTPPASYNLDDDQAAWENELQKMTRGQLQDELEK
GERDNAELQEFANAILQQIADHCPD
Storage
-20C
Provider Type Product Number
- No reagents -