HPA002329

OTUB2 antibody from Sigma-Aldrich
C14orf137, FLJ21916, MGC3102
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002329
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002329, RRID:AB_1079537
Product name
Anti-OTUB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002329
Antibody type
Polyclonal
Antigen
Ubiquitin thioesterase OTUB2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRL
LTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMA
TECDHIQITALSQALSIALQVEYVDEMDTALNHHV
FPEAATPSVYLLYKTSHYNIL
Storage
-20C
Provider Type Product Number
- No reagents -