Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00723961-B01P - Provider product page
- Provider
- Abnova Corporation
- Product name
- INS-IGF2 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human INS-IGF2 protein.
- Antigen sequence
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHL
VEALYLVCGERGFFYTPKTRREAEDLQASALSLSS
STSTWPEGLDATARAPPALVVTANIGQAGGSSSRQ
FRQRALGTSDSPVLFIHCPGAAGTAQGLEYRGRRV
TTELVWEEVDSSPQPQGSESLPAQPPAQPAPQPEP
QQAREPSPEVSCCGLWPRRPQRSQN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Analysis artefacts of the INS-IGF2 fusion transcript.
Autoimmunity against INS-IGF2 protein expressed in human pancreatic islets.
Wernersson R, Frogne T, Rescan C, Hansson L, Bruun C, Grønborg M, Jensen JN, Madsen OD
BMC molecular biology 2015 Jul 29;16:13
BMC molecular biology 2015 Jul 29;16:13
Autoimmunity against INS-IGF2 protein expressed in human pancreatic islets.
Kanatsuna N, Taneera J, Vaziri-Sani F, Wierup N, Larsson HE, Delli A, Skärstrand H, Balhuizen A, Bennet H, Steiner DF, Törn C, Fex M, Lernmark Å
The Journal of biological chemistry 2013 Oct 4;288(40):29013-23
The Journal of biological chemistry 2013 Oct 4;288(40):29013-23
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of INS-IGF2 expression in transfected 293T cell line (H00723961-T01) by INS-IGF2 MaxPab polyclonal antibody.Lane 1: INS-IGF2 transfected lysate(22 KDa).Lane 2: Non-transfected lysate.