HPA004932

INS-IGF2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004932
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004932, RRID:AB_1851816
Product name
Anti-INS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004932
Antibody type
Polyclonal
Antigen
Insulin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVE
LGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSL
YQLENYC
Storage
-20C
Provider Type Product Number
- No reagents -