Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00114793-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00114793-M01, RRID:AB_437006
- Product name
- FMNL2 monoclonal antibody (M01), clone 2B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FMNL2.
- Antigen sequence
MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDA
KIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVK
AYKQAEEENELRKKQEQALMEKLLEQEALMEQQDP
KSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDG
AIEDIITALKKNNITKFPNVHSRVRISSSTPVVED
TQS- Isotype
- IgG
- Antibody clone number
- 2B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Down-regulation of formin-like 2 predicts poor prognosis in hepatocellular carcinoma.
FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.
FMNL2 enhances invasion of colorectal carcinoma by inducing epithelial-mesenchymal transition.
Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.
Overexpression of FMNL2 is closely related to metastasis of colorectal cancer.
Liang L, Guan J, Zeng Y, Wang J, Li X, Zhang X, Ding Y
Human pathology 2011 Nov;42(11):1603-12
Human pathology 2011 Nov;42(11):1603-12
FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.
Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L
The Journal of pathology 2011 Jul;224(3):377-88
The Journal of pathology 2011 Jul;224(3):377-88
FMNL2 enhances invasion of colorectal carcinoma by inducing epithelial-mesenchymal transition.
Li Y, Zhu X, Zeng Y, Wang J, Zhang X, Ding YQ, Liang L
Molecular cancer research : MCR 2010 Dec;8(12):1579-90
Molecular cancer research : MCR 2010 Dec;8(12):1579-90
Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.
Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R
Oncogene 2010 Apr 22;29(16):2441-8
Oncogene 2010 Apr 22;29(16):2441-8
Overexpression of FMNL2 is closely related to metastasis of colorectal cancer.
Zhu XL, Liang L, Ding YQ
International journal of colorectal disease 2008 Nov;23(11):1041-7
International journal of colorectal disease 2008 Nov;23(11):1041-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FMNL2 monoclonal antibody (M01), clone 2B4 Western Blot analysis of FMNL2 expression in IMR-32 ( Cat # L008V1 ).