HPA005464

FMNL2 antibody from Sigma-Aldrich
FHOD2, KIAA1902
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005464
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005464, RRID:AB_1848965
Product name
Anti-FMNL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005464
Antibody type
Polyclonal
Antigen
Formin-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERVEELEENISHLSEKLQDTENEAMSKIVELEKQL
MQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAI
QRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVV
ASGTLSMGSEVVAGNSVGP
Storage
-20C
Provider Type Product Number
- No reagents -