Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000226-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000226-M03, RRID:AB_1111663
- Product name
- ALDOA monoclonal antibody (M03), clone 2E6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ALDOA.
- Antigen sequence
HRIVAPGKGILAADESTGSIAKRLQSIGTENTEEN
RRFYRQLLLTADDRVNPCIGGVILFHETLYQKADD
GRPFP- Isotype
- IgG
- Antibody clone number
- 2E6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ALDOA monoclonal antibody (M03), clone 2E6. Western Blot analysis of ALDOA expression in NIH/3T3(Cat # L018V1 ).