Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310977 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aldolase A, Fructose-Bisphosphate (ALDOA) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALDOA antibody: synthetic peptide directed towards the N terminal of human ALDOA
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Rabbit, Xenopus
- Host
- Rabbit
- Antigen sequence
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADE
STGSI AKRLQSIGTE- Vial size
- 0.1 mg
Submitted references Involvement of aldolase A in X-ray resistance of human HeLa and UV(r)-1 cells.
[Significance of Golgi glycoprotein 73, a new tumor marker in diagnosis of hepatocellular carcinoma: a primary study].
Lu J, Suzuki T, Satoh M, Chen S, Tomonaga T, Nomura F, Suzuki N
Biochemical and biophysical research communications 2008 May 9;369(3):948-52
Biochemical and biophysical research communications 2008 May 9;369(3):948-52
[Significance of Golgi glycoprotein 73, a new tumor marker in diagnosis of hepatocellular carcinoma: a primary study].
Mao YL, Yang HY, Xu HF, Sang XT, Lu X, Yang ZY, Zhang JC, Zhong SX, Huang JF, Zhang HB
Zhonghua yi xue za zhi 2008 Apr 8;88(14):948-51
Zhonghua yi xue za zhi 2008 Apr 8;88(14):948-51
No comments: Submit comment
No validations: Submit validation data