Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004177 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004177, RRID:AB_1078128
- Product name
- Anti-ALDOA
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
IVAPGKGILAADESTGSIAKRLQSIGTENTEENRR
FYRQLLLTADDRVNPCIGGVILFHETLYQKADDGR
PFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQG
L- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differentially expressed proteins in malignant and benign adrenocortical tumors.
Comparative proteomics analysis of gastric cancer stem cells.
Fructose-bisphosphate aldolase a is a potential metastasis-associated marker of lung squamous cell carcinoma and promotes lung cell tumorigenesis and migration.
Kjellin H, Johansson H, Höög A, Lehtiö J, Jakobsson PJ, Kjellman M
PloS one 2014;9(2):e87951
PloS one 2014;9(2):e87951
Comparative proteomics analysis of gastric cancer stem cells.
Morisaki T, Yashiro M, Kakehashi A, Inagaki A, Kinoshita H, Fukuoka T, Kasashima H, Masuda G, Sakurai K, Kubo N, Muguruma K, Ohira M, Wanibuchi H, Hirakawa K
PloS one 2014;9(11):e110736
PloS one 2014;9(11):e110736
Fructose-bisphosphate aldolase a is a potential metastasis-associated marker of lung squamous cell carcinoma and promotes lung cell tumorigenesis and migration.
Du S, Guan Z, Hao L, Song Y, Wang L, Gong L, Liu L, Qi X, Hou Z, Shao S
PloS one 2014;9(1):e85804
PloS one 2014;9(1):e85804
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows moderate positivity in myocytes.
- Sample type
- HUMAN