HPA023031

antibody from Atlas Antibodies

Targeting: MRM3 FLJ10581, HC90, RMTL1, RNMTL1

Antibody data

Submit

Validation data

Product number: HPA023031 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023031, RRID:AB_1856387
Product name: Anti-MRM3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPV DKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKP DHVKMTYPKTQLQHSLPLLLICDNLRDPGN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MRM3 protein structure - HPA023031 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-MRM3 antibody. Corresponding MRM3 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, lymph node and testis using Anti-MRM3 antibody HPA023031 (A) shows similar protein distribution across tissues to independent antibody HPA022534 (B).
Antibody #2 product nr: HPA023292, HPA022534
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MRM3 antibody HPA023031.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MRM3 antibody HPA023031.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MRM3 antibody HPA023031.
Sample type: HUMAN