HPA023031

MRM3 antibody from Atlas Antibodies
FLJ10581, HC90, RMTL1, RNMTL1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023031
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023031, RRID:AB_1856387
Product name
Anti-MRM3
Provider product page
Atlas Antibodies - HPA023031
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPV
DKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKP
DHVKMTYPKTQLQHSLPLLLICDNLRDPGN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -