HPA023292

antibody from Atlas Antibodies

Targeting: MRM3 FLJ10581, HC90, RMTL1, RNMTL1

Antibody data

Submit

Validation data

Product number: HPA023292 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA023292, RRID:AB_1856388
Product name: Anti-MRM3
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: EEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIG GETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNS AMAASILLFEGKRQLRGRAEDLSRDRSYH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MRM3 protein structure - HPA023292 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, lymph node and testis using Anti-MRM3 antibody HPA023292 (A) shows similar protein distribution across tissues to independent antibody HPA022534 (B).
Antibody #2 product nr: HPA023031, HPA022534
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong cytoplasmic positivity with granular pattern in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MRM3 antibody HPA023292.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MRM3 antibody HPA023292.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MRM3 antibody HPA023292.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MRM3 antibody HPA023292.
Sample type: HUMAN