HPA022534

MRM3 antibody from Sigma-Aldrich
FLJ10581, HC90, RMTL1, RNMTL1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022534
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022534, RRID:AB_1856386
Product name
Anti-RNMTL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022534
Antibody type
Polyclonal
Antigen
RNA methyltransferase-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGK
QPRKAPSEASAQEQREKQPLEESASRAPSTWEESG
LRYDKAYPGDRRLSSVMTIVKSRPFRE
Storage
-20C
Provider Type Product Number
- No reagents -