HPA023256

CCDC25 antibody from Sigma-Aldrich
FLJ10853
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023256
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023256, RRID:AB_2072067
Product name
Anti-CCDC25 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023256
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 25 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLS
SAHVYLRLHKGENIEDIPKEVLMD
Storage
-20C
Provider Type Product Number
- No reagents -