HPA023566

NXN antibody from Sigma-Aldrich
FLJ12614, NRX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023566
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023566, RRID:AB_1854737
Product name
Anti-NXN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023566
Antibody type
Polyclonal
Antigen
Nucleoredoxin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRD
YTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVE
AFVNDFLAEKLKPEPI
Storage
-20C
Provider Type Product Number
- No reagents -