HPA002321

MVP antibody from Sigma-Aldrich
LRP, VAULT1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002321
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002321, RRID:AB_1079277
Product name
Anti-MVP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002321
Antibody type
Polyclonal
Antigen
Major vault protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVS
RRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLG
PHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQP
GEQLEQGIQDVYVLS
Storage
-20C
Provider Type Product Number
- No reagents -