H00000190-M03A

NR0B1 antibody from Abnova Corporation
AHC, AHCH, DAX1, DSS

Antibody data

Product number
H00000190-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000190-M03A, RRID:AB_1578157
Product name
NR0B1 monoclonal antibody (M03A), clone 1F10
Provider product page
Abnova Corporation - H00000190-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NR0B1.
Antigen sequence
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQ
CVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELN
STLFLLRFINANVIAELFFRPIIGTVSMDDMMLEM
LCTKI
Isotype
IgG
Antibody clone number
1F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -