HPA019035

ABCB11 antibody from Atlas Antibodies
ABC16, BSEP, PFIC-2, PFIC2, PGY4, SPGP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019035
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019035, RRID:AB_1844429
Product name
Anti-ABCB11
Provider product page
Atlas Antibodies - HPA019035
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLSTVRAADTIIGFEHGTAVERGTHEELLERKGVY
FTLVTLQSQGNQALNEEDIKDATEDDMLARTFSRG
SYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST
YEEDRKDKDIPVQEEVEPAPVRRILK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -