HPA063522

BRICD5 antibody from Atlas Antibodies
C16orf79, MGC21830

Antibody data

Product number
HPA063522
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063522, RRID:AB_2685029
Product name
Anti-BRICD5
Provider product page
Atlas Antibodies - HPA063522
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLEVDPAQAGALVQRLCMRTPIYWARRAEGPRRQR
LIY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -