PAB21063

BRICD5 antibody from Abnova Corporation
C16orf79, MGC21830

Antibody data

Product number
PAB21063
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21063, RRID:AB_10967694
Product name
C16orf79 polyclonal antibody
Provider product page
Abnova Corporation - PAB21063
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C16orf79.
Antigen sequence
LRMTLPSPHMPRPNQTILVDVARNAATITVTPPQS
NHSWAVLFDGQSGCICYRPEEHQVCFLRLMEDSDR
ETLRLLVDTSKVQEAWVPSQDTHHTQELLAVQGS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -