HPA019197

BRICD5 antibody from Sigma-Aldrich
C16orf79, MGC21830
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019197
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019197, RRID:AB_1853864
Product name
Anti-C16orf79 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019197
Antibody type
Polyclonal
Antigen
Hypothetical protein LOC283870 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRMTLPSPHMPRPNQTILVDVARNAATITVTPPQS
NHSWAVLFDGQSGCICYRPEEHQVCFLRLMEDSDR
ETLRLLVDTSKVQEAWVPSQDTHHTQELLAVQGS
Storage
-20C
Provider Type Product Number
- No reagents -