HPA002317

BIRC3 antibody from Atlas Antibodies
API2, c-IAP2, cIAP2, hiap-1, MALT2, MIHC, RNF49
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002317
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002317, RRID:AB_1846748
Product name
Anti-BIRC3
Provider product page
Atlas Antibodies - HPA002317
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQL
LSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTP
VINAAVEMGFSRSLVKQTVQRKILATGENYRLVND
LVLDLLNAEDEIREEERERATEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -