HPA002317

BIRC3 antibody from Atlas Antibodies
API2, c-IAP2, cIAP2, hiap-1, MALT2, MIHC, RNF49
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002317
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002317, RRID:AB_1233885
Product name
Anti-BIRC3
Provider product page
Atlas Antibodies - HPA002317
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQL
LSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTP
VINAAVEMGFSRSLVKQTVQRKILATGENYRLVND
LVLDLLNAEDEIREEERERATEE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -