HPA002317

BIRC3 antibody from Sigma-Aldrich
API2, c-IAP2, cIAP2, hiap-1, MALT2, MIHC, RNF49
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002317
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002317, RRID:AB_1846748
Product name
Anti-BIRC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002317
Antibody type
Polyclonal
Antigen
Baculoviral IAP repeat-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQL
LSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTP
VINAAVEMGFSRSLVKQTVQRKILATGENYRLVND
LVLDLLNAEDEIREEERERATEE
Storage
-20C
Provider Type Product Number
- No reagents -