PAB21734

SCARA5 antibody from Abnova Corporation
FLJ23907, MGC45780, NET33

Antibody data

Product number
PAB21734
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21734, RRID:AB_10964685
Product name
SCARA5 polyclonal antibody
Provider product page
Abnova Corporation - PAB21734
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SCARA5.
Antigen sequence
PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLT
EQVWKVQDALQNQSDSLLALAGAVQRLE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -