HPA024661

SCARA5 antibody from Sigma-Aldrich
FLJ23907, MGC45780, NET33
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024661
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024661, RRID:AB_1853902
Product name
Anti-SCARA5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024661
Antibody type
Polyclonal
Antigen
Scavenger receptor class A member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLT
EQVWKVQDALQNQSDSLLALAGAVQRLE
Storage
-20C
Provider Type Product Number
- No reagents -