H00009933-B01

PUM3 antibody from Abnova Corporation
HA-8, hPUF-A, KIAA0020, PEN, PUF6, XTP5

Antibody data

Product number
H00009933-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009933-B01, RRID:AB_11190295
Product name
KIAA0020 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00009933-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human KIAA0020 protein.
Antigen sequence
MEVKGKKQFTGKNTKTAQEKNRFHKNSDSGSSKTF
PTRKVAKEGGPKVTSRNFEKSITKLGKKGVKQFKN
KQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAA
KKPKWDDFKKKKKELKQSRQLSDKTNYDIVVRAKQ
MWEILRRKDCDKEKRVKLMSDLQKLIQGKIKTIAF
AHDSTRVIQCYIQYGNEEQRKQAFEELRDDLVELS
KAKYSRNIVKKFLMYGSKPQIAEIIRSFKGHVRKM
LRHAEASAIVEYAYNDKAILEQRNMLTEELYGNTF
QLYKSADHPTLDKVLELQPEKLELIMDEMKQILTP
MAQKEAVIKHSLVHKVFLDFFTYAPPKLRSEMIEA
IREAVVYLAHTHDGARVAMHCLWHGTPKDRKVIVK
TMKTYVEKVANGQYSHLVLLAAFDCIDDTKLVKQI
IISEIISSLPSIVNDKYGRKVLLYLLSPRDPAHTV
REIIEVLQKGDGNAHSKKDTEVRRRELLESISPAL
LSYLQEHAQEVVLDKSACVLVSDILGSATGDVQPT
MNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKW
LIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWAS
VNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLE
KTKSTSKGIEILLEKLST
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -