ABIN633588

PUM3 antibody from antibodies-online
HA-8, hPUF-A, KIAA0020, PEN, PUF6, XTP5

Antibody data

Product number
ABIN633588
Provider
antibodies-online
Product name
anti-KIAA0020 (KIAA0020) (N-Term) antibody
Provider product page
antibodies-online - ABIN633588
Antibody type
Polyclonal
Antigen
KIAA0020 antibody was raised using the N terminal of KIAA0020 corresponding to a region with amino acids EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSR
Description
Affinity purified
Reactivity
Human
Host
Rabbit
Epitope
N-Term
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -