ABIN183931
antibody from antibodies-online
Targeting: PUM3
HA-8, hPUF-A, KIAA0020, PEN, Puf-A, PUF6, XTP5
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183931 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-KIAA0020 (KIAA0020) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the N terminal of human KIAA0020
- Description
- Protein A purified
- Reactivity
- Human, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQ
PDGRS DESAAKKPKW- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Percolation on heterogeneous networks as a model for epidemics.
Feasibility of using genetic linkage analysis to identify the genes encoding T cell-defined minor histocompatibility antigens.
Sander LM, Warren CP, Sokolov IM, Simon C, Koopman J
Mathematical biosciences 2002 Nov-Dec;180:293-305
Mathematical biosciences 2002 Nov-Dec;180:293-305
Feasibility of using genetic linkage analysis to identify the genes encoding T cell-defined minor histocompatibility antigens.
Warren EH, Otterud BE, Linterman RW, Brickner AG, Engelhard VH, Leppert MF, Martin PJ, Riddell SR
Tissue antigens 2002 Apr;59(4):293-303
Tissue antigens 2002 Apr;59(4):293-303
No comments: Submit comment
No validations: Submit validation data