HPA002353

PUM3 antibody from Atlas Antibodies
HA-8, hPUF-A, KIAA0020, PEN, Puf-A, PUF6, XTP5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002353
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002353, RRID:AB_1852266
Product name
Anti-PUM3
Provider product page
Atlas Antibodies - HPA002353
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIA
SLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQD
KKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGA
IILSSLLQSCDLEVANKVKAALKSLIPTLEKTKST
SKGI
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -