AV46213

PUM3 antibody from Sigma-Aldrich
HA-8, hPUF-A, KIAA0020, PEN, PUF6, XTP5
No application information provided.

Antibody data

Product number
AV46213
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV46213, RRID:AB_1852262
Product name
Anti-KIAA0020 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV46213
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KIAA0020 with an internal ID of p27048
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFP
TRKVAKEGGPKVTSR
Storage
-20C
Provider Type Product Number
- No reagents -