HPA002353

PUM3 antibody from Sigma-Aldrich
HA-8, hPUF-A, KIAA0020, PEN, PUF6, XTP5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002353
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002353, RRID:AB_1852266
Product name
Anti-KIAA0020 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002353
Antibody type
Polyclonal
Antigen
Pumilio domain-containing protein KIAA0020 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIA
SLAATGLHPGGKDGELHIAEHPAGHLVLKWLIEQD
KKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGA
IILSSLLQSCDLEVANKVKAALKSLIPTLEKTKST
SKGI
Storage
-20C
Provider Type Product Number
- No reagents -