HPA020553

CIDEC antibody from Atlas Antibodies
CIDE-3, FLJ20871, Fsp27
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020553
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020553, RRID:AB_1846769
Product name
Anti-CIDEC
Provider product page
Atlas Antibodies - HPA020553
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDT
VFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDV
ARVT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -