H00063924-M07

CIDEC antibody from Abnova Corporation
CIDE-3, FLJ20871, Fsp27

Antibody data

Product number
H00063924-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063924-M07, RRID:AB_1573990
Product name
CIDEC monoclonal antibody (M07), clone 2E2
Provider product page
Abnova Corporation - H00063924-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CIDEC.
Antigen sequence
SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEE
DGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQ
GTRHPLSLSHKPAKKIDVA
Isotype
IgG
Antibody clone number
2E2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -