HPA018837

CIDEC antibody from MilliporeSigma / Merck KGaA
CIDE-3, FLJ20871, Fsp27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018837
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018837, RRID:AB_1846767
Product name
Anti-CIDEC antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018837
Antibody type
Polyclonal
Antigen
Cell death activator CIDE-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEP
SPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLK
Storage
-20C
Provider Type Product Number
- No reagents -