PAB21080

VCPKMT antibody from Abnova Corporation
C14orf138, METTL21D, VCP-KMT

Antibody data

Product number
PAB21080
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21080, RRID:AB_10965220
Product name
METTL21D polyclonal antibody
Provider product page
Abnova Corporation - PAB21080
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant METTL21D.
Antigen sequence
DTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGG
VGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVL
ELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMN
INMNKHLVTGSVQAKGGRNRRLSFSTRLHTDGRLH
I
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -