HPA076561

VCPKMT antibody from Atlas Antibodies
C14orf138, METTL21D, VCP-KMT

Antibody data

Product number
HPA076561
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA076561, RRID:AB_2732312
Product name
Anti-VCPKMT
Provider product page
Atlas Antibodies - HPA076561
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EIEGFPSPPDFILMADCIYYEESLEPLLKTLKDIS
GFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDF
EKIPLEKHDEEYRSEDIHIIYIRKK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -