HPA001146

VCPKMT antibody from Sigma-Aldrich
C14orf138, METTL21D, VCP-KMT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001146
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001146, RRID:AB_1845558
Product name
Anti-C14orf138 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001146
Antibody type
Polyclonal
Antigen
Uncharacterized protein C14orf138 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTLESSLEDPLRSFVRVLEKRDGTVLRLQQYSSGG
VGCVVWDAAIVLSKYLETPEFSGDGAHALSRRSVL
ELGSGTGAVGLMAATLGADVVVTDLEELQDLLKMN
INMNKHLVTGSVQAKGGRNRRLSFSTRLHTDGRLH
I
Storage
-20C
Provider Type Product Number
- No reagents -