HPA006021

MTIF2 antibody from Sigma-Aldrich
IF-2mt
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006021
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006021, RRID:AB_2147687
Product name
Anti-MTIF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006021
Antibody type
Polyclonal
Antigen
Translation initiation factor IF-2, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAI
LNIIDTYDASHECELELVHFGVGDISANDVNLAET
FDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYR
LVEDLQEELSSRLPCAVEEHPVGEASILATFSVTE
GKKKVPVAGC
Storage
-20C
Provider Type Product Number
- No reagents -