Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009352-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009352-M01, RRID:AB_464359
- Product name
- TXNL1 monoclonal antibody (M01), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TXNL1.
- Antigen sequence
GPKYVKIFINLPRSMDFEEAERSEPTQALELTEDD
IKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTR
ISYFTFIGTPVQATNMNDFKRVVGKKGESH- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
Gemoll T, Roblick UJ, Szymczak S, Braunschweig T, Becker S, Igl BW, Bruch HP, Ziegler A, Hellman U, Difilippantonio MJ, Ried T, Jörnvall H, Auer G, Habermann JK
Cellular and molecular life sciences : CMLS 2011 Oct;68(19):3261-74
Cellular and molecular life sciences : CMLS 2011 Oct;68(19):3261-74
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TXNL1 monoclonal antibody (M01), clone 1A10 Western Blot analysis of TXNL1 expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TXNL1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol