HPA002828

antibody from Atlas Antibodies

Targeting: TXNL1 TRP32, Txl, TXNL

Western blot (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Immunohistochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

HPA002828

Provider

Atlas Antibodies

Proper citation

Atlas Antibodies Cat#HPA002828, RRID:AB_1858358

Product name

Anti-TXNL1

Antibody type

Polyclonal

Reactivity

Human, Mouse, Rat

Host

Rabbit

Conjugate

Unconjugated

Antigen sequence

CLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAF
NQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDF
EEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNV
NSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMN
DFKRVVGK


Isotype

IgG

Vial size

100 µl

Storage

Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Western blot

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in human cell line HL-60.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Sample type

HUMAN

Immunohistochemistry

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse ambiguus nucleus shows positivity in neuronal cell bodies.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows positivity in subsets of neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse motor cortex shows immunoreactivity in neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hypothalamus shows positivity in the neurons of paraventricular nucleus.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hippocampus shows immunoreactivity in a subset of neurons in the polymorph layer.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse facial nucleus shows positivity in neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human hippocampus shows moderate nuclear and cytoplasmic immunoreactivity in neurons.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows strong nuclear immunoreactivity in Purkinje cells.

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human cerebral cortex shows positivity in subsets of neurons.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunohistochemical staining of human hippocampus shows moderate nuclear and cytoplasmic positivity in neurons.

Sample type

HUMAN

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse dentate gyrus shows positivity in a subset of neurons in the polymorph layer .

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse medulla oblongata shows positivity in neurons in the facial nucleus.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse brain shows positivity in neuronal cells in the motor cortex.

Sample type

MOUSE

Supportive validation

Submitted by

Atlas Antibodies (provider)

Main image

Experimental details

Immunofluorescence staining of mouse hypothalamus shows positivity in neurons in the paraventricular hypothalamic nucleus.

Sample type

MOUSE