HPA002828

TXNL1 antibody from Sigma-Aldrich
TRP32, Txl, TXNL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002828
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002828, RRID:AB_1858358
Product name
Anti-TXNL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002828
Antibody type
Polyclonal
Antigen
Thioredoxin-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAF
NQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDF
EEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNV
NSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMN
DFKRVVGK
Storage
-20C
Provider Type Product Number
- No reagents -