Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00171023-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00171023-M05, RRID:AB_10616617
- Product name
- ASXL1 monoclonal antibody (M05), clone 6E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant ASXL1.
- Antigen sequence
MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQIL
QVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLF
YKLPGRISLFTLKR- Isotype
- IgG
- Antibody clone number
- 6E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Silencing of ASXL1 impairs the granulomonocytic lineage potential of human CD34⁺ progenitor cells.
Davies C, Yip BH, Fernandez-Mercado M, Woll PS, Agirre X, Prosper F, Jacobsen SE, Wainscoat JS, Pellagatti A, Boultwood J
British journal of haematology 2013 Mar;160(6):842-50
British journal of haematology 2013 Mar;160(6):842-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ASXL1 monoclonal antibody (M05), clone 6E2. Western Blot analysis of ASXL1 expression in MCF-7(Cat # L046V1 ).
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ASXL1 monoclonal antibody (M05), clone 6E2. Western Blot analysis of ASXL1 expression in K-562.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol