Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310832 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tetraspanin 32 (TSPAN32) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TSPAN32 antibody: synthetic peptide directed towards the middle region of human TSPAN32
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRL
GSTEA DLCQGEEAAR- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular characterisation of mouse and human TSSC6: evidence that TSSC6 is a genuine member of the tetraspanin superfamily and is expressed specifically in haematopoietic organs.
Robb L, Tarrant J, Groom J, Ibrahim M, Li R, Borobakas B, Wright MD
Biochimica et biophysica acta 2001 Nov 11;1522(1):31-41
Biochimica et biophysica acta 2001 Nov 11;1522(1):31-41
No comments: Submit comment
No validations: Submit validation data